Skip to content


Make money with Domain Names: Affiliate Marketing + Pay Per Click (PPC) in Minisite

affiliatemarketingpayperclickppcdomainnamedevelopment Make money with Domain Names: Affiliate Marketing + Pay Per Click (PPC) in MinisiteI’ve so far made 6 of my domain names into minisites, they’re all doing quite well with my expectations and is picking up good numbers of visitors every day. All of which were premium ccTLDs, which were equipped with WordPress and with Pay Per Click (PPC) Advertisements. I’ve then tried getting myself some .COM domain names which I’m experimenting with Affiliate Marketing…


I’ve recently bought the domain name LodgingBeach.com, which is highly searched for in search engines (around 200,000 searches). What I like about it is that it is a highly targeted keyword and focusing on a niche which is beach lodging. Also U.S. has a good reputation on purchasing online which makes it great for affiliate marketing to which .COM’s are good to use. My premium ccTLDs might be getting great traffic but people here in the Philippines are not quite open to spending money online. I’m currently on the development stage which is still on the designing and writing up articles right now.


lodgingbeach Make money with Domain Names: Affiliate Marketing + Pay Per Click (PPC) in Minisite


Try to click on Hotels (on the top navigation) and see where that leads you. Notice a slight difference in design, but check your address bar and see how I’ve linked it to HotelsCombined. I found it really cool as it gave a personal branding to it and does a great price comparison which saves my visitors lots of money. So it’s a win for my visitors and it’s a win for me as well, as I get paid when they book (a percentage).



But I’m still not letting go of the PPC, there should be a good few percentage who wouldn’t want to buy but might click on advertisements. So I’m currently experimenting on combining both revenue sources and see which could do well in the long run. I’ll be closely monitoring this and will be writing about it when I launch the website.


Subscribe to TechFilipino Now!

Subscribe domaining web development Make money with Domain Names: Affiliate Marketing + Pay Per Click (PPC) in Minisite
  RSS Updates on TechFilipino

Twitter technology Make money with Domain Names: Affiliate Marketing + Pay Per Click (PPC) in Minisite

  Twitter Updates on Internet & Domaining


Or Subscribe Via Email and get FREE Email Updates!

 Make money with Domain Names: Affiliate Marketing + Pay Per Click (PPC) in Minisite

Other Articles you might also like:

  1. Why Affiliate Marketing is better than PPC
  2. Why PPC is the first step to Affiliate Marketing
  3. Diversifying from PPC to Affiliate Marketing
  4. Part 4 WordPress Themes, Minisite Design: Ultimate guide to Making Money with Minisites using PPC

11 Responses

Follow this Conversation, subscribe to our RSS feed for comments on this post.

Continuing the Discussion

  1. What is the best way to design a Minisite? - Developing Domain Names | TechFilipino linked to this post on August 31, 2009

    [...] … As we all know, minisites have existed for a very very long time, some people have even developed an empire out of it. What’s different is that some design it really 1.0 ish and some have really stepped up with their designs. What we all need to remember here is that these are ‘investments‘ and like any other investment, we expect a good return on investment (ROI). Common ways of earning money thru minisites are Pay-per-click (PPC), Affiliate Marketing and Direct Advertising. [...]

  2. $100 Google Adsense from Minisites, ad placement | TechFilipino linked to this post on October 1, 2009

    [...] it is a milestone. The first goal of every publisher is to receive their first payment from their PPC. Minisites have been my tool to reach that goal, and thanks to the power of domain names I’m [...]

  3. Increase your minisite’s CTR | TechFilipino linked to this post on October 11, 2009

    [...] If you’re serving PPC ads in your minisites, CTR is something that you have to really understand and focus on.Your goal [...]

  4. Domain Name development: The decline of domain name values | TechFilipino linked to this post on November 4, 2009

    [...] machines with minisites (I recommend this), portals, or other web projects that would monetize thru PPC or Affiliate Marketing. Instead of parking and getting small revenues, it might be worth getting better SEO, which gives [...]

  5. Getting a Generic Domain Name Doesn’t always Guarantee success - Domain Name Entrepreneurship | TechFilipino linked to this post on November 4, 2009

    [...] zero planning and lots of capital to burn. It’s even worse than a minisite as it contains all the adsense and affiliate marketing links without any relevant contents. I feel that the domain name is wasted and is pretty much what [...]

  6. To invest or not to invest in Typo Domain names | TechFilipino linked to this post on November 4, 2009

    [...] and how much your conscience can take. If your goal is to gain traffic to your website or earn from PPC or parking then it is a good path to invest as it really gets a lot of spill over traffic. But if [...]

  7. How to start domaining / investing in domain names | TechFilipino linked to this post on November 4, 2009

    [...] and the right buyer will come along thru organic searches. What’s also good is that you could monetize thru PPC or Affiliate marketing, which could be good enough to cover the register + renewal fees and could make you self [...]

  8. Return of Investment (ROI) for a .COM minisite is 3 months | TechFilipino linked to this post on November 12, 2009

    [...] that people from other countries (especially US) pay higher costs for each click in your minisites Pay per click (PPC) [...]

  9. Why Affiliate Marketing is better than PPC | TechFilipino linked to this post on November 23, 2009

    [...] In Affiliate Marketing, the way they track is by giving you a special link to which you send traffic to. They usually give you links like http://WEBSITE.com/referid=?1234, which does all the tracking so there’s nothing on your end to do except drive traffic to that link. While people are starting to be more meticulous to links, there are affiliate link masking to make it more attractive to clicks. These are links like http://techfilipino.com/recommend/godaddy. (see more affiliate masking plugins here) [...]

  10. Why would you sell your domain? | TechFilipino linked to this post on November 28, 2009

    [...] that makes them rich at some point, and mine’s developing. Once the domain is developed you could earn a decent income or if you can’t then you could flip it for a decent sum. I would only sell my [...]

Some HTML is OK

(required)

(required, but never shared)

or, reply to this post via trackback.



Login with Facebook:

Get Adobe Flash playerPlugin by wpburn.com wordpress themes